Tag feed

#gans

58 posts10 followers

Explore Hashnode

Alternatives

Trending tags this week

NFnishu facilemarketingwhitepapers.hashnode.devJan 20 · 3 min read

Generative Adversarial Networks Empowering AI to Create and Innovate

Artificial Intelligence is no longer just about analyzing data—it’s now creating it. One of the most powerful technologies behind this shift is Generative Adversarial Networks (GANs). GANs enable machines to generate realistic images, videos, audio, ...

0

COCynthia Oluchukwuluchii.hashnode.devOct 17, 2025 · 5 min read

Week 4 & 5 Research Journey: Deep Diving into Synthetic Data and GANs for Rare Disease Prediction

Introduction These past two weeks (Weeks 4 and 5) have been some of the most intellectually challenging yet rewarding stages of my research journey. My project, titled “Synthetic Data Generation for Rare Disease Prediction: Leveraging GANs to Address...

0

EAElvis Anselmelvisanselm.hashnode.devOct 11, 2025 · 17 min read

My Introduction to Generative Adversarial Networks (GANs)

I've enjoyed learning about AI Engineering and the many technologies that make up this field. For three months, it's felt like I'm discovering a new concept every day. I know it's almost impossible to learn everything you come across, so I've learnt ...

0

SMSatwik Mishrademystifying.hashnode.devOct 8, 2025 · 7 min read

How You Can Use GANs For Synthetic Data Generation

Have you ever started a project only to realize your dataset is too small? Maybe you're fine-tuning an LLM architecture, but don't have enough domain-specific examples. Or you've needed data with specific characteristics that your real data simply do...

0

JPJidhun Puthuppattujidhun.hashnode.devAug 29, 2025 · 3 min read

Generative AI and Data Science

The rise of Generative Artificial Intelligence (AI) marks a significant milestone in the broader field of artificial intelligence and its intersection with data science. Unlike traditional AI systems that focus on classification, prediction, or optim...

0

KJKhushal Jhaveribuilding-an-ai-that-understands-emotions.hashnode.devApr 15, 2025 · 3 min read

🔍 Visualizing Sorting Algorithms with AI: Using Vision Transformers and GANs to Teach Logic

So this project started as something I thought would be cool — I wanted to take boring sorting algorithms like Bubble Sort or Merge Sort and actually visualize them in a way that’s clear and makes people go, “Ohhh, now I get it.” But instead of just ...

0

OTOmkar Thorvechashmishcoder.hashnode.devApr 1, 2025 · 9 min read

How CycleGAN is Revolutionizing AI-Powered Image Transformation

In recent years, Generative Adversarial Networks (GANs) have emerged as powerful tools for image generation and transformation. Among these innovative architectures, CycleGAN stands out as a revolutionary approach that has significantly advanced the ...

0

RTRetzam Tarleretzam.hashnode.devFeb 24, 2025 · 5 min read

Generative Adversarial Networks

Hello 🕶️, A Generative Adversarial Network (GAN) is a type of Neural Network in which two neural network models compete to improve each other iteratively. GANs are the most versatile neural networks. They are used in generative AI to create new samp...

0

CKChandan Kumarliladhar.hashnode.devFeb 12, 2025 · 4 min read

Generative Adversarial Networks (GANs): An Overview

Generative Adversarial Networks (GANs) are a class of machine learning models designed for generative tasks, where they create new data samples similar to the given dataset. They consist of two neural networks, a Generator and a Discriminator, that c...

0

ASAkhil Soniakhilworld.hashnode.devJan 19, 2025 · 5 min read

Getting GANs

Hey guys, let’s start this article in a different way. One of my friend has a very good vision and he is very good in playing a game where we have to find differences between two images having a very few differences. While playing the game, one of my...

0

#gans

Search Hashnode

#gans

Explore Hashnode

Trending tags this week

Generative Adversarial Networks Empowering AI to Create and Innovate

Week 4 & 5 Research Journey: Deep Diving into Synthetic Data and GANs for Rare Disease Prediction

My Introduction to Generative Adversarial Networks (GANs)

How You Can Use GANs For Synthetic Data Generation

Generative AI and Data Science

🔍 Visualizing Sorting Algorithms with AI: Using Vision Transformers and GANs to Teach Logic

How CycleGAN is Revolutionizing AI-Powered Image Transformation

Generative Adversarial Networks

Generative Adversarial Networks (GANs): An Overview

Getting GANs